Protein Info for A4249_RS07990 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: sulfur carrier protein ThiS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 66 PF02597: ThiS" amino acids 4 to 66 (63 residues), 56.1 bits, see alignment E=2.2e-19 TIGR01683: thiamine biosynthesis protein ThiS" amino acids 4 to 66 (63 residues), 72.7 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: K03154, sulfur carrier protein (inferred from 64% identity to aex:Astex_3004)

MetaCyc: 37% identical to ThiS sulfur carrier protein (Bacillus subtilis subtilis 168)

Predicted SEED Role

"Sulfur carrier protein ThiS" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZE6 at UniProt or InterPro

Protein Sequence (66 amino acids)

>A4249_RS07990 sulfur carrier protein ThiS (Brevundimonas sp. GW460-12-10-14-LB2)
MHQIHLNGEPRQVRAATILALVEELSLDPRKVAVERNLEIVPKSLHAATPVAAGDRIELV
QFVGGG