Protein Info for A4249_RS07970 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: uridine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00485: PRK" amino acids 4 to 182 (179 residues), 126.4 bits, see alignment E=1.3e-40

Best Hits

Swiss-Prot: 44% identical to URK_CLOBM: Uridine kinase (udk) from Clostridium botulinum (strain Loch Maree / Type A3)

KEGG orthology group: K00876, uridine kinase [EC: 2.7.1.48] (inferred from 81% identity to bsb:Bresu_2332)

Predicted SEED Role

"Uridine kinase (EC 2.7.1.48)" (EC 2.7.1.48)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZG2 at UniProt or InterPro

Protein Sequence (215 amino acids)

>A4249_RS07970 uridine kinase (Brevundimonas sp. GW460-12-10-14-LB2)
MTILIAITGGSGSGKSTLAEALVSALPEGSAVLVREDSYYKDAASLPGFDAATFDFDDVT
ARDHDLMIADLKALKAGRAVTAPVYSFIHHGREPGGEPIPAAEVVIVEGTHVLCTPDLTA
LFDIRVFVDTPADIRFIRRLLRDQAERGRSADSVVAQYLATVRPGHERLTEPSRTHADFI
VADATAAVRLEDPQAVVRLAAPVLAHPLLQALLGD