Protein Info for A4249_RS07920 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: metalloregulator ArsR/SmtB family transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF12840: HTH_20" amino acids 17 to 62 (46 residues), 42.1 bits, see alignment 4.7e-14 PF01022: HTH_5" amino acids 18 to 62 (45 residues), 49.6 bits, see alignment 2.1e-16 PF12802: MarR_2" amino acids 18 to 63 (46 residues), 34.7 bits, see alignment 1.1e-11 PF01209: Ubie_methyltran" amino acids 111 to 267 (157 residues), 44.6 bits, see alignment E=8.3e-15 PF13489: Methyltransf_23" amino acids 142 to 263 (122 residues), 53.7 bits, see alignment E=1.4e-17 PF00891: Methyltransf_2" amino acids 149 to 254 (106 residues), 32.8 bits, see alignment E=3.3e-11 PF05175: MTS" amino acids 151 to 253 (103 residues), 26.2 bits, see alignment E=3.9e-09 PF13847: Methyltransf_31" amino acids 153 to 261 (109 residues), 68.8 bits, see alignment E=3.3e-22 PF13649: Methyltransf_25" amino acids 154 to 247 (94 residues), 65.2 bits, see alignment E=5.1e-21 PF08241: Methyltransf_11" amino acids 155 to 251 (97 residues), 77.7 bits, see alignment E=6e-25 PF08242: Methyltransf_12" amino acids 155 to 249 (95 residues), 54.9 bits, see alignment E=8.6e-18

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 78% identity to bsb:Bresu_2317)

Predicted SEED Role

"Transcriptional regulator, ArsR family / Methyltransferase fusion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZF6 at UniProt or InterPro

Protein Sequence (319 amino acids)

>A4249_RS07920 metalloregulator ArsR/SmtB family transcription factor (Brevundimonas sp. GW460-12-10-14-LB2)
MSLSADQTVEALRAAGEPTRLRVLSLLAGEELSVMEMSRILDQSQPRVSRHLKLMTDAGL
IERFPDGARVYYRLSHDAQARRLIDTVLDILAEDAGEADHRRLDEVRKDREEAAASYFEQ
VAPQWDRLRSLYVSESAVEAALEKAVGPGPFERVVDLGTGSGRMLTLFGKKAKMSVGLDL
SQNMLNIARTNVTKAGVEQVELRHGDIFATRLPAASADLVIVHQVLHYLSDPSAAVAEAA
RLVSPNGRLVIIDFAPHDFEHMREAHQHRRLGFADSEINGWLLDGGLTPSAPIALPHDAE
GLTVTIWTAERRVQDRKTA