Protein Info for A4249_RS07880 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: RluA family pseudouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00849: PseudoU_synth_2" amino acids 26 to 179 (154 residues), 108.2 bits, see alignment E=2.4e-35

Best Hits

KEGG orthology group: None (inferred from 76% identity to bsb:Bresu_1548)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase C (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70

Use Curated BLAST to search for 4.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NJ40 at UniProt or InterPro

Protein Sequence (240 amino acids)

>A4249_RS07880 RluA family pseudouridine synthase (Brevundimonas sp. GW460-12-10-14-LB2)
MTRVPADLSSDDIAAVRSWVIHEDAHVIAFSKPPGLSSQGGRIKAHTLDDLLWAFARSNG
KRPELVHRLDRDTSGVILAAKTKPAASFLGKALQMRRFRKQYLALLSAAPEPKAATIDAP
LRREEIGRESYVRVVAFDAPGAQGSQSRYRTLAAGPEGAVVELEPLTGRMHQLRVHMAHI
GRPLIGDVRYGGALTTPVGPAPRLMLHAAKLSFPHPEGGTTTVEAPPPEDFAKLRTALGL