Protein Info for A4249_RS07805 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: NAD kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF01513: NAD_kinase" amino acids 26 to 68 (43 residues), 30.9 bits, see alignment 3.2e-11 PF20143: NAD_kinase_C" amino acids 109 to 197 (89 residues), 37.5 bits, see alignment E=1.9e-13

Best Hits

Swiss-Prot: 70% identical to NADK_CAUVC: NAD kinase (nadK) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 82% identity to bsb:Bresu_1482)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161I7H9 at UniProt or InterPro

Protein Sequence (250 amino acids)

>A4249_RS07805 NAD kinase (Brevundimonas sp. GW460-12-10-14-LB2)
MAFVASDRPEAQAARKALIARYGAVPEDEADVIVALGGDGQMLETLHGNLRQRTPVYGMN
RGSVGFLMNDYDENGLLERIATAERTVIHPLQMDAWTESGEVHTGLAINEVSLLRQTRQS
AKLRITVDERVRLEELSCDGCLVATPAGSTAYNLSAHGPIIPLDARILALTPISAFRPRR
WRGALLSHGAKVRFEVLEADKRPVSATADNFEVRRVARVEVRERRDVTLSMLFDAGRSFD
ERVMAEQFAN