Protein Info for A4249_RS07785 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 50 to 356 (307 residues), 220.7 bits, see alignment E=1.2e-69 PF16576: HlyD_D23" amino acids 59 to 272 (214 residues), 94.9 bits, see alignment E=6.4e-31 PF13437: HlyD_3" amino acids 169 to 270 (102 residues), 52.9 bits, see alignment E=8.4e-18

Best Hits

KEGG orthology group: None (inferred from 72% identity to bsb:Bresu_1486)

MetaCyc: 31% identical to vibriobactin efflux pump periplasmic adaptor protein (Vibrio cholerae O1 biovar El Tor str. N16961)
TRANS-RXN-502

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HX55 at UniProt or InterPro

Protein Sequence (367 amino acids)

>A4249_RS07785 efflux RND transporter periplasmic adaptor subunit (Brevundimonas sp. GW460-12-10-14-LB2)
MIKRHFFLVAAAVLLALMVVAAIVKVSAGDEKKAAGPGGGRGRGAQQVSEAVVAQRPFSD
QIRVLGVARGERSVNVTSSTTELITRVLFADGQYVSAGAPLVELQAREEDAAIIEARANV
NQAQREYDRYKALADRGVAPQVMLEQAETALETARASLQAAQARRGDRVIRSPFSGRVGL
TTVTPGTLINPGAVITTLDDTSTIRVDFPLPERYLNLLRPGAQLTATADAYGDEPFTGRI
ALIDTRVNETTRAATARAEFPNPGGRIRPGMLMRVAVQQGQRQSAAVPESAVQYEGAGAF
VYRIAPGQNGSTAQRVEVETGAVENGFVEILSGIEAGDRIVGSGLNRIQPGAPVSVGGQG
RESGAAK