Protein Info for A4249_RS07765 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ferrous iron transporter B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 transmembrane" amino acids 223 to 248 (26 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 283 to 307 (25 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 363 to 387 (25 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 463 to 482 (20 residues), see Phobius details amino acids 494 to 513 (20 residues), see Phobius details amino acids 518 to 542 (25 residues), see Phobius details amino acids 560 to 583 (24 residues), see Phobius details amino acids 594 to 617 (24 residues), see Phobius details PF01926: MMR_HSR1" amino acids 9 to 126 (118 residues), 63.6 bits, see alignment E=3.7e-21 PF02421: FeoB_N" amino acids 9 to 169 (161 residues), 184.5 bits, see alignment E=2e-58 PF07670: Gate" amino acids 290 to 385 (96 residues), 71.8 bits, see alignment E=1.2e-23 amino acids 462 to 589 (128 residues), 63.7 bits, see alignment E=3.9e-21 PF07664: FeoB_C" amino acids 403 to 455 (53 residues), 58.5 bits, see alignment 8.6e-20

Best Hits

KEGG orthology group: K04759, ferrous iron transport protein B (inferred from 81% identity to bsb:Bresu_1489)

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZB3 at UniProt or InterPro

Protein Sequence (622 amino acids)

>A4249_RS07765 ferrous iron transporter B (Brevundimonas sp. GW460-12-10-14-LB2)
MDIALKTARVALVGNPNSGKTALFNALTGAHQKVANYAGVTVERKEGLIRAASGRTMSVL
DLPGTYSLRARSPDEEVTRDAVLGRLAGETTPDVVVCVADATNLRLVLRLILELKAVGRP
MVLALNMYDIAQRQGLRIDLERLRAELGVPIITTVATRKRGIDDLVAAIEDQAAVAAVTE
SQWRSPDAAELRTAAREAERIMKACVRPPERPDTLTGRIDSVLLHPVGGLLILFALLFVM
FQAVFSWAAPVMDGIEAGIAWLGGLVANVLPDGLLQSLIVDGIISGVGSVLVFLPQILIL
FLFIIALEDFGYMARAAFLMDKIMGGAGLHGRAFIPLLSSFACAIPGVMAARVIDSRRDR
LTTILVAPLMTCSARIPVYTLIIAAFIPNETVWGFANLQGLVMFGLYAAGIVSALIVSLL
IRKVFWRGAVEPFMMELPAYKTPDLRSVGFNLWLRAKIFLNRAGRIILPLVIILWVLATF
PYPPENATLPAIDYSFAGMLGRALAPIFAPIGFNWQMVIALIPGMAAREVAVAALGTTYA
IADAENATGLLASTLASHWSLATALSFLAWYIFAPQCVATLGVVRRETNSLKWTWIMIGY
MFGLAYLASLVTYHVAVALGGG