Protein Info for A4249_RS07715 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details amino acids 387 to 409 (23 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 351 (321 residues), 64 bits, see alignment E=6e-22

Best Hits

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 46% identity to avn:Avin_17660)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXD5 at UniProt or InterPro

Protein Sequence (421 amino acids)

>A4249_RS07715 MFS transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MVIETDAAHTAGGLAKPAGSLNGPLAFAIACFLIWGLAYGLLDVLNKHFQETLSISQADS
AWLQIAYFGAYLLLSIPAGMLLHARGYKFGLVSGLAVTAVGALLFIPAAGAGAFLPFVGS
MFVLAAGLCILETSADTYVNVLGDPAKASQRLNLAQSFNALGVFFGPLIGGAVFFSPTTT
EALGGATRSIQIVYGLIAVGVVLFALAVWRARLPETGLSDHGGAVAGDAPARPLSQQPHF
TAGVITQALYIGAQVGIGAYFINLVTHNWQGLTSQQGAFMLSLAAVGYLVGRFFATALLL
KIKPRVLLTAYGVINVILTLIVAAGIDKVSPIALLAVFFFMSTMFATIFALGTTGLGAGT
KKASSLMVMAIGGGVLLPWPMGRIADLYGANVAFLLPAACFAVVAWYGWKGAGLGLKAET
K