Protein Info for A4249_RS07680 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: FMN-dependent L-lactate dehydrogenase LldD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF01070: FMN_dh" amino acids 13 to 375 (363 residues), 424.3 bits, see alignment E=5.4e-131 PF01645: Glu_synthase" amino acids 294 to 336 (43 residues), 22.5 bits, see alignment 8.7e-09

Best Hits

Swiss-Prot: 81% identical to LLDD_ECOK1: L-lactate dehydrogenase (lldD) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 81% identity to ecv:APECO1_2850)

MetaCyc: 80% identical to L-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.5.M6 [EC: 1.1.5.M6]; RXN0-7227 [EC: 1.1.5.M6]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3 or 1.1.5.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZV8 at UniProt or InterPro

Protein Sequence (377 amino acids)

>A4249_RS07680 FMN-dependent L-lactate dehydrogenase LldD (Brevundimonas sp. GW460-12-10-14-LB2)
MIISSPSDYREAARRKLPPFLFHYIDGGAYAEQTLRRNVEDWQAIALRQRVLQDMTSLSL
ETKLFDETLRLPIILGPVGLTGMYARRGEVQAAKAAALRGVPFTMSTVSVCPIEEVAPAI
DRPMWFQLYVLRDRGFMRNALERAKAEGVKTLVFTVDMPTPGARYRDAHSGMSGPNAEIR
RMVQAMTHPAWAWDVGVRGTPHDLGNVSAYLGKPTGLADYIGWLANNFDPSISWKDLQWI
RDFWDGPMIIKGILDPQDARDAVSFGADGIVVSNHGGRQLDGVLSSACALPAIANAVQGE
LKILVDSGIRNGLDVVRAIALGADAVLLGRAFIYALAANGQAGVENLLDLFEKEMRVAMT
LTGAKSVTGMTREMLAI