Protein Info for A4249_RS07650 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF00356: LacI" amino acids 16 to 61 (46 residues), 63.1 bits, see alignment 3.3e-21 PF00532: Peripla_BP_1" amino acids 75 to 322 (248 residues), 66.2 bits, see alignment E=6.8e-22 PF13407: Peripla_BP_4" amino acids 76 to 297 (222 residues), 39.3 bits, see alignment E=1.1e-13 PF13377: Peripla_BP_3" amino acids 184 to 344 (161 residues), 133.7 bits, see alignment E=1.4e-42

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 77% identity to bsb:Bresu_3165)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZ97 at UniProt or InterPro

Protein Sequence (349 amino acids)

>A4249_RS07650 LacI family DNA-binding transcriptional regulator (Brevundimonas sp. GW460-12-10-14-LB2)
MAQDDPRSGKPGKRATINDVAREAQVSKKTVSRVINQSPFVKEDTREKVNAVIKALGFTP
DPQARGLAFRRSFLVGLIYDNPSPTYVVNMQQGVLDALKGSGLELVVHPCNRNSPTLLED
IRGFVERQRLYGVIMPPSVSEDEQVIDLLRDLDCPYVRIASVALDEPQAMVVTNDWLGAA
EAAAHLADLGHRRIGLVRGPDLFRSSAVRGKGFLDALAERGIPLDPAYDFKGAYTFESGV
EAGHALLALETPPTAIFTLNDDMAIGVMQAARDRGLELPRDLSVVGFDDLPMAARVWPNL
TSVRLPIRDMGRMAAEKLLAPMRGVDPATMQQPEVRPALVVRKSAIPVV