Protein Info for A4249_RS07645 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 98 to 273 (176 residues), 33 bits, E=2.5e-12

Best Hits

KEGG orthology group: K02554, 2-keto-4-pentenoate hydratase [EC: 4.2.1.80] (inferred from 62% identity to bsb:Bresu_3164)

Predicted SEED Role

"2-keto-4-pentenoate hydratase (EC 4.2.1.80)" (EC 4.2.1.80)

MetaCyc Pathways

• 2-hydroxypenta-2,4-dienoate degradation (1/3 steps found)
• catechol degradation I (meta-cleavage pathway) (1/5 steps found)
• toluene degradation II (aerobic) (via 4-methylcatechol) (1/6 steps found)
• catechol degradation II (meta-cleavage pathway) (1/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (1/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (1/7 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (1/8 steps found)
• p-cumate degradation (1/8 steps found)
• 4-chloronitrobenzene degradation (1/9 steps found)
• meta cleavage pathway of aromatic compounds (1/10 steps found)
• L-tryptophan degradation IX (2/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (2/12 steps found)
• p-cymene degradation (1/11 steps found)
• naphthalene degradation to acetyl-CoA (1/12 steps found)
• toluene degradation IV (aerobic) (via catechol) (1/13 steps found)
• mandelate degradation to acetyl-CoA (1/18 steps found)
• superpathway of aerobic toluene degradation (1/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (3/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (4/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Carbazole degradation
• Ethylbenzene degradation
• Fluorene degradation
• Phenylalanine metabolism
• Styrene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.80

Sequence Analysis Tools

See A0A160HZ92 at UniProt or InterPro

Protein Sequence (278 amino acids)

>A4249_RS07645 fumarylacetoacetate hydrolase family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTSTPSLASQDDALSADPAAIAQQFVAARLAARNTPDYPGVIPQSMAESYAIQDVAIGLF
PDKVVGWKVGGVPPEQQPKLGIHRLAGAIFARNVWPAPGDTVVPLPEIEGGFAAVEAEFI
ARIGADADPAKTDWTIEDAMGVVDKVFIGVELAGSPLSTINDLGSAVVASDFGNNGGLMI
GPEVENWRDRLDGIEVETVINGASVGTGGSQSLAGGAMESVRFLLEHCARWGRPLKAGTL
VSTGAVTGVHRVHAGDEAVCIFKGIAELHCSVVRAEAQ