Protein Info for A4249_RS07615 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: HD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF12917: YfbR-like" amino acids 34 to 128 (95 residues), 33.7 bits, see alignment E=3e-12 PF01966: HD" amino acids 44 to 83 (40 residues), 22.6 bits, see alignment 1.1e-08

Best Hits

Swiss-Prot: 58% identical to Y048_RHOCB: Uncharacterized protein RCAP_rcc00048 (RCAP_rcc00048) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K06952, (no description) (inferred from 86% identity to bsb:Bresu_2412)

Predicted SEED Role

"COG1896: Predicted hydrolases of HD superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NXK4 at UniProt or InterPro

Protein Sequence (197 amino acids)

>A4249_RS07615 HD family hydrolase (Brevundimonas sp. GW460-12-10-14-LB2)
MLSGRRLDLLDPSPFDIEIEDIAHGLARVARWNGQTIGEHAFSVAQHSCVVEEIAAHIKP
GLDPKWRLAALLHDASEYVIGDMISPFKAALGAGYKDFEAKLEAAIHLRYGLPPKTPQTI
KTLIKKADKACAFFEATQLAGFTEKESLGFFGSPPQGYSLTIEPQPAPVAQARYLERYRV
LAGAVGLIPADDAWHTE