Protein Info for A4249_RS07345 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: lipoyl(octanoyl) transferase LipB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00214: lipoyl(octanoyl) transferase
  • amino acids 51 to 208 (158 residues), 151 bits, E=1.4e-48

Best Hits

Swiss-Prot: 70% identical to LIPB_CAUVC: Octanoyltransferase (lipB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03801, lipoyl(octanoyl) transferase [EC: 2.3.1.181] (inferred from 79% identity to bsb:Bresu_2395)

Predicted SEED Role

"Octanoate-[acyl-carrier-protein]-protein-N-octanoyltransferase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.181

Sequence Analysis Tools

See A0A160HWZ6 at UniProt or InterPro

Protein Sequence (238 amino acids)

>A4249_RS07345 lipoyl(octanoyl) transferase LipB (Brevundimonas sp. GW460-12-10-14-LB2)
MLAEPLSPSLQKLCLDDGRPVEWAVSKGYIDYAAAEAFMEARVAAIAAGEANEMVWLLEH
PPLYTAGVSAKDDDLLDAGRFPVHRTGRGGQFTYHGPGQRVAYVMLDLNRRGKDVRCFVR
GLELWLIGALDTFGVKADIRPGRVGVWVERKGAGWSREDKIAAIGVKVRKWVSFHGISLN
VEPDLENFGGIVPCGIQEHGVTSLVDLGVLATMDEADEALRRSFDRIFGAAVEAPAPL