Protein Info for A4249_RS07260 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: aldo/keto reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF00248: Aldo_ket_red" amino acids 16 to 307 (292 residues), 275.7 bits, see alignment E=2e-86

Best Hits

Swiss-Prot: 51% identical to ALKR4_ARATH: Probable aldo-keto reductase 4 (At1g60710) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 79% identity to bsb:Bresu_1625)

MetaCyc: 47% identical to perakine reductase (Rauvolfia serpentina)
RXN-12673 [EC: 1.1.1.317]

Predicted SEED Role

"Aldo-keto reductase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.317

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZ41 at UniProt or InterPro

Protein Sequence (328 amino acids)

>A4249_RS07260 aldo/keto reductase (Brevundimonas sp. GW460-12-10-14-LB2)
MKTRKFGANGPEVSAIGLGCMGMSAFYGGSDEAQSTSVIHRALDLGITLFDTAEMYGPHT
NEVLVGKALKDRRDQAFIATKFGINYNADRTRLMTDGSPANVRRAIEGSLQRLGVDHVDL
YYLHRVDPDTPIEDTVGAMAELVKEGKVRFLGLSEAASDTLRKAHATHPITALQTEYSLW
SREPEDELFAVVRELGIGFVPYSPLGRGFLSGDITSIDDLEADDFRRTNPRFMGENFQKN
LDLVEAVKAIASDKGITAAQLALAWVLAQGEDLIPIPGTRRIATLEQNAAAVDVVLTPED
IARIEAVFPKGAATGHRYAEAARAALNR