Protein Info for A4249_RS07230 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ribose-5-phosphate isomerase RpiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 5 to 222 (218 residues), 244.6 bits, E=3.7e-77
• PF06026: Rib_5-P_isom_A
  • amino acids 48 to 221 (174 residues), 192 bits, E=3.3e-61

Best Hits

Swiss-Prot: 68% identical to RPIA_CAUVN: Ribose-5-phosphate isomerase A (rpiA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 85% identity to bsb:Bresu_1569)

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• pentose phosphate pathway (7/8 steps found)
• Bifidobacterium shunt (12/15 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• oxygenic photosynthesis (11/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

See A0A168NI90 at UniProt or InterPro

Protein Sequence (227 amino acids)

>A4249_RS07230 ribose-5-phosphate isomerase RpiA (Brevundimonas sp. GW460-12-10-14-LB2)
MSDLQKKNAGQAAAAHVEAGMIVGLGTGSTAAWFVKALAARNLPDLRCVPTSEKTADLAR
ELGLTLSTLEDTPRIDLTVDGADEIGPCLALIKGGGAALLREKLVWEASARCIVIADAAK
VVPVLGTFPLPIEVVAFGHKTTANRIADVLIDHDINQPARVRQADRGLVRTDGGNLIYDA
GCRAIHDPVRLADDLKLITGVVEHGLFLDLADLAIIGTDEGVEERLP