Protein Info for A4249_RS07215 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details PF00375: SDF" amino acids 10 to 395 (386 residues), 392.5 bits, see alignment E=1.1e-121

Best Hits

KEGG orthology group: None (inferred from 93% identity to bsb:Bresu_1564)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HX37 at UniProt or InterPro

Protein Sequence (429 amino acids)

>A4249_RS07215 dicarboxylate/amino acid:cation symporter (Brevundimonas sp. GW460-12-10-14-LB2)
MLARFFKIPLWQRTAAGFILGIIAGLILRERAETWLQPIGDVYLNLIRMVVAPLVLFTIA
SSIAKLGEGAGAVRLGVRTIVWFAITSLLAVLVGFAFGHIINPGVGLSNLPLGEVKERVI
PTPLEVLIGVVPTNPFAALAEGKVLQIIFFSALVGMALVALGDRAQGVRRLVDEGAAVIF
RITRWVIQLTPIGVFGLIGSVVGGYGWEALLPLVKFILAIYAACLFHILIVYSGLLKIHG
LKVTSFFRGAFAAQQTAFATSSSLGTLPITLRQTVERLGVPQAYAAFAVPLGANVKMDGC
GAIYPAIASIFIAQYFKIDLTLTQYVLIGLTAVLGSLGTAGVPGTSIVMLTLTLSTAGLP
LEGIGYIVAIDRIIDMMRTATNVTGQMLVPVLVAKEEGILNQDIYNGHVAWLPGDPEANT
PEGVRAAGI