Protein Info for A4249_RS06825 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: pantoate--beta-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR00018: pantoate--beta-alanine ligase" amino acids 9 to 286 (278 residues), 263 bits, see alignment E=1.2e-82 PF02569: Pantoate_ligase" amino acids 9 to 284 (276 residues), 321.9 bits, see alignment E=1.4e-100

Best Hits

Swiss-Prot: 60% identical to PANC_CAUVC: Pantothenate synthetase (panC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 73% identity to bsb:Bresu_1576)

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYX6 at UniProt or InterPro

Protein Sequence (286 amino acids)

>A4249_RS06825 pantoate--beta-alanine ligase (Brevundimonas sp. GW460-12-10-14-LB2)
MIDAAPLPVVRTVADLRAIVRDWKRQGLSVGMVPTMGALHEGHLTLVREAARRADRVVAS
NFVNPTQFAAHEDLGKYPRQQEEDARLLAGAGCHLMFAPSADEMYPEGFATTVAVAGPAL
GLEGDFRPQMFGGVAVVVTKLFNQVQPDVAIFGEKDYQQLMVVRRFVRDLDLPVEIVGAP
TERDGWGLALSSRNAYLSETELETARRLNGILAEAGVHASSGRPLPGVEREAYAALLKAG
FDRVDYVAIRHAEDLTPFRNDIVDAPARILAAAWLGKTRLIDNMAV