Protein Info for A4249_RS06515 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ergothioneine biosynthesis protein EgtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 TIGR03440: ergothioneine biosynthesis protein EgtB" amino acids 16 to 399 (384 residues), 510.2 bits, see alignment E=5.5e-157 PF12867: DinB_2" amino acids 18 to 147 (130 residues), 36 bits, see alignment E=1.4e-12 PF03781: FGE-sulfatase" amino acids 183 to 319 (137 residues), 88.2 bits, see alignment E=1.1e-28 amino acids 324 to 399 (76 residues), 31 bits, see alignment E=3.2e-11 TIGR03438: dimethylhistidine N-methyltransferase" amino acids 418 to 714 (297 residues), 367 bits, see alignment E=7.3e-114 PF10017: Methyltransf_33" amino acids 418 to 718 (301 residues), 357.6 bits, see alignment E=7.2e-111

Best Hits

KEGG orthology group: None (inferred from 70% identity to bsb:Bresu_1736)

Predicted SEED Role

"FIG00449589: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NXG2 at UniProt or InterPro

Protein Sequence (719 amino acids)

>A4249_RS06515 ergothioneine biosynthesis protein EgtB (Brevundimonas sp. GW460-12-10-14-LB2)
MNARSEPDPRVASDVARFKAVRARMIDLAEGLSAEDLSAQSMADCSPGKWHLAHTSWFFE
AMILSSDPGYQPVDPRFQQLFNSYYEALGERVRRDQRGLMTRPSVDEVLAYRREIDRRMV
AWLAQGETSGHQRYLFELGLHHDQQHQELFLMDVLNLMSRSPLDPAAYEIEPRTEPLQIR
RGGTVAFDGGMVTIGHDQSDFAFDNEGPAHRVWLEPFALAADLVTNGDWIAFIQDGGYSR
SDLWLSDGWATVKSEGWTAPLYWRREDGDWTVLGLTGRTPVDLAAPVRHISFYEADAYAR
WAGKRLPSEAEWEHAAASSPDAFSNLAGEVWQWTSSAYAPYPGFQPTPGTAAEYNGKFMA
NQMVLRGGSFATPPGHDRITYRNFFYPQQRWAFMGLRLAEDRTVARDAAADDAQTAAFRK
DMIEGLSRAQKAVPPKWFYDADGSRLFEDITLLPEYYPTRQEMALLRDRAAELTADFGPD
AVLVEFGSGASEKTRILLDAATDLGAYVPLDISESALMDAAIRVRADYPTLRVQPVLGDF
EHLAPLPEDLPSGRRIGFFPGSTIGNLQPDEAEQFLAAARRMLGEGALFILGVDLVKDPA
ILFAAYDDSQGVTAAFNRNVLIRANHELDADFDVDAFVHRAVWNPDASRMEMHLQAIAPT
TAHVGDRTFRFMTGETIHTESSRKFTPESIQAMAAASGWTVVRIDTSPAPSVALAVLRA