Protein Info for A4249_RS06365 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: NADH-quinone oxidoreductase subunit NuoI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 21 to 141 (121 residues), 154.1 bits, E=6e-50
• PF13237: Fer4_10
  • amino acids 61 to 114 (54 residues), 26.5 bits, E=2.9e-09
• PF00037: Fer4
  • amino acids 61 to 80 (20 residues), 24 bits, see alignment (E = 1.4e-08)
  • amino acids 97 to 118 (22 residues), 32.8 bits, see alignment (E = 2.4e-11)
• PF12800: Fer4_4
  • amino acids 62 to 76 (15 residues), 17.8 bits, see alignment (E = 1.8e-06)
  • amino acids 102 to 115 (14 residues), 13.6 bits, see alignment (E = 4.1e-05)
• PF13187: Fer4_9
  • amino acids 63 to 118 (56 residues), 34.3 bits, E=1.1e-11
• PF12838: Fer4_7
  • amino acids 63 to 117 (55 residues), 48.9 bits, E=4e-16

Best Hits

Swiss-Prot: 86% identical to NUOI_CAUVC: NADH-quinone oxidoreductase subunit I (nuoI) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 87% identity to bsb:Bresu_1947)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See A0A160HYR5 at UniProt or InterPro

Protein Sequence (163 amino acids)

>A4249_RS06365 NADH-quinone oxidoreductase subunit NuoI (Brevundimonas sp. GW460-12-10-14-LB2)
MFTRIVQATKGAMMLDVIGAIGLSLKYMARPKMTVNYPFERNPQSPRFRGEHALRRYANG
EERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMVKCIYCGLCQEACPVDAIVE
GPNSEFAVETREELLYDKQRLLDNGDRWERQIAKNLELDAPYR