Protein Info for A4249_RS06355 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: NADH-quinone oxidoreductase subunit NuoK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 90% identical to NUOK_CAUVN: NADH-quinone oxidoreductase subunit K (nuoK) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 90% identity to ccs:CCNA_02018)

MetaCyc: 52% identical to ferredoxin-quinone oxidoreductase subunit E (Parasynechococcus marenigrum WH 8102)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
aerobic respiration I (cytochrome c) (3/4 steps found)
NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
NAD(P)/NADPH interconversion (3/6 steps found)
Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY22 at UniProt or InterPro

Protein Sequence (101 amino acids)

>A4249_RS06355 NADH-quinone oxidoreductase subunit NuoK (Brevundimonas sp. GW460-12-10-14-LB2)
MIGLTHYLTVAAILFTIGVFGIFVNRKNVIIILMSIELILLAVNINFVAFSAYLNEISGQ
IMAMFVLTVAAAEAAVGLAILVTFFRNRGDIAVDDASVMKG