Protein Info for A4249_RS06300 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: lipoprotein-releasing ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 31 to 57 (27 residues), see Phobius details amino acids 285 to 309 (25 residues), see Phobius details amino acids 329 to 359 (31 residues), see Phobius details amino acids 394 to 411 (18 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 14 to 428 (415 residues), 401.1 bits, see alignment E=2.9e-124 PF12704: MacB_PCD" amino acids 37 to 257 (221 residues), 59.5 bits, see alignment E=5.7e-20 PF02687: FtsX" amino acids 288 to 421 (134 residues), 54.9 bits, see alignment E=8.8e-19

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 76% identity to bsb:Bresu_1962)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2J6 at UniProt or InterPro

Protein Sequence (428 amino acids)

>A4249_RS06300 lipoprotein-releasing ABC transporter permease subunit (Brevundimonas sp. GW460-12-10-14-LB2)
MSLPSRPSGAFSSWEIGLALRYLRAKRKEGGVATIAVISFIGIMLAVAVLISVMSIMSGF
RSELLGRMLAFNGHMYVQGQVLTSPDREAALKRIQAVPGVASASPLNEAQSLIRVGSYTT
GAIAKGIRPEDLAKTQYVFDSLSPQERASFGKGPYGGDRILVGAALANSMGLRVGDPVTL
YSPTGADSAFGNLGGLEKTYFVGGLFRSGAADYDRAFIFMPLEQQQLFFGKEGVWDAIEI
KVDDPDQVGALTAAIRDAAGPGSVVSDWRERLAAFYGALKVERVAMSIILGLVVAIAAMN
IISGIVMLVKNKGRDIAILRTIGASPSAILRVFFMAGAMIGVAGTIAGLILGLLFCWNIG
SIQHFLEFVLQTKLFDSDVYMLDAIPALVDPVDVTWVAFWSLLMSCIASLPPSWNASRID
PVEALRYE