Protein Info for A4249_RS06235 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: outer membrane protein assembly factor BamA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 814 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 71 to 814 (744 residues), 764.5 bits, see alignment E=6.5e-234 PF07244: POTRA" amino acids 138 to 215 (78 residues), 59.4 bits, see alignment E=7.3e-20 amino acids 220 to 306 (87 residues), 48.5 bits, see alignment E=1.8e-16 amino acids 309 to 388 (80 residues), 55.1 bits, see alignment E=1.5e-18 amino acids 391 to 463 (73 residues), 49.2 bits, see alignment E=1.1e-16 PF01103: Omp85" amino acids 491 to 814 (324 residues), 228.4 bits, see alignment E=2.5e-71

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 74% identity to bsb:Bresu_2491)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161IJH3 at UniProt or InterPro

Protein Sequence (814 amino acids)

>A4249_RS06235 outer membrane protein assembly factor BamA (Brevundimonas sp. GW460-12-10-14-LB2)
MNDMTSRAAVRLSARSSLLALAVAAGLGAPALAQTAPAQTAPTTTPVAPVQTAPASAAEP
RVEIAAPQTITINRIIVQGAQRIDQTTVLSYLPIRPGDAVDASVLDVAVRTLSRTGLFAD
VQLGIQNGDLIVQIVENPIINQVVFEGNKALSKDKLTKEVTLAPRGIYTRAKVQEDVGAI
VELYRLQGRISATVTPKLVQLEQNRVDVIFEINEGPQTGISAINVLGNEAFSDRDVRGVM
VTEKSTWWKFFSNNDNYDPNRLEYDQEQLRKFYTNRGYYDFRVVSSVAELQPDDQAFQLT
LTLNEGDKYNFGEIKVVTQNDRLNADFLKALVPIREGQLYESDKIEQAVDALTFAAGSAG
YAFVEINPTYKANPETDTVDVTFNVSEGQRVYIDRINVVGNTRTIDPVIRRELLLTEGDA
FNRALMERSRNNLRALGFFKDVTVEETRGSAPDRSIINVNVQEQPTGELSVGAGFSSVDS
FTVNLGISERNFRGRGQNVVARLEWGSLRQQVDFRFTEPKFLGRDLRAGFDLFHSRYDLS
QYSSYDYRSTGAGLRLSYPLNGNMLLSTRYFLKSDEIIVPTGFCSGVGQGSSALCDQIGS
FINSSAGYTLQVNYTNDPIRPTRGWAGSLRQDLAGLGGDVNYVKTEADASWYYGITPAWV
VSVQGSTGYVSGWNGDPIRINDRFFKGGNSFRGFETAGMGPRDLNTTDALGGNFYAIGTV
ELTVPNYLPEQYGIKTSLFADVGTLGVLDDRYKLTSTGTVNTNIADELSLRASAGVSIHW
KSPMGPIRFDISKVLSKEDYDKTESFRFSTSTQF