Protein Info for A4249_RS06175 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: indole-3-glycerol phosphate synthase TrpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00218: IGPS
  • amino acids 5 to 261 (257 residues), 308 bits, E=2.1e-96

Best Hits

Swiss-Prot: 75% identical to TRPC_PHEZH: Indole-3-glycerol phosphate synthase (trpC) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K01609, indole-3-glycerol phosphate synthase [EC: 4.1.1.48] (inferred from 75% identity to pzu:PHZ_c1761)

Predicted SEED Role

"Indole-3-glycerol phosphate synthase (EC 4.1.1.48)" in subsystem Tryptophan synthesis (EC 4.1.1.48)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.48

Sequence Analysis Tools

See A0A168NGR2 at UniProt or InterPro

Protein Sequence (264 amino acids)

>A4249_RS06175 indole-3-glycerol phosphate synthase TrpC (Brevundimonas sp. GW460-12-10-14-LB2)
MTDVLDRIATYKREDVAARKAATSQDAIEALARAASAPRGFRAALERVGEETGRPALIAE
IKKASPSKGLIRPDFDPPALARAYEAGGAACLSVLTDGPSFQGDDAYLGQAREAVALPCL
RKDFLVDPWQVAESRALGADCILIILAMVDDRLAAELLSEAERFGMDALIETHDEDEMAR
ACALGGDLVGVNNRSLRTFEVDLETTERLSMLSPVRALLVAESGIFTPDDVARVSAAHAQ
AILVGESLMRQADVEAATRQLLAV