Protein Info for A4249_RS06095 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: patatin-like phospholipase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF01734: Patatin" amino acids 26 to 221 (196 residues), 94 bits, see alignment E=7.3e-31

Best Hits

KEGG orthology group: K07001, (no description) (inferred from 71% identity to bsb:Bresu_2564)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I237 at UniProt or InterPro

Protein Sequence (355 amino acids)

>A4249_RS06095 patatin-like phospholipase family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MAIFKRKTAEAANIVPAAPARRPICLALQGGGAHGAFQWGVLDRLLEDDRLDIRAVSGVS
AGAMNGTALVSGLASGDGRAALDKLWREVNQSGGRNVFGDSAIWNAARTPDWIKDNPFWR
AGETLAMSMSPYEFNPLNHNPLKRVLQASVDFGAVQASDIRLFVAATAVRQAKARIFQTN
EINADVLMASACLPHLFQALEIDGEPYWDGGYLTNPPLWPLTGDDTPDDVLLITLNPMVR
DETPKSAGDIVDRLNEIVFNAPLVAELRAIALAGELIEHGQLKGGGAGPYRHVRLHAIEA
DGWLSDLSLRSKFNTEWGFLNDLKARGRAAADDWLNACVSSVGRQSSVDLQARFG