Protein Info for A4249_RS06090 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: 3-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF00106: adh_short" amino acids 25 to 219 (195 residues), 194.8 bits, see alignment E=1.7e-61 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 25 to 280 (256 residues), 372.3 bits, see alignment E=5.1e-116 PF08659: KR" amino acids 28 to 180 (153 residues), 35.7 bits, see alignment E=1.3e-12 PF13561: adh_short_C2" amino acids 33 to 278 (246 residues), 187.6 bits, see alignment E=4.4e-59

Best Hits

Swiss-Prot: 60% identical to BDHA_RHIME: D-beta-hydroxybutyrate dehydrogenase (bdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 77% identity to bsb:Bresu_2563)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NGN0 at UniProt or InterPro

Protein Sequence (280 amino acids)

>A4249_RS06090 3-hydroxybutyrate dehydrogenase (Brevundimonas sp. GW460-12-10-14-LB2)
MSQEPKDSTGADSRTARGIGDLKGQVAVITGSTSGIGLALARAVAAGGGEVVLNGLGDPA
EIERTRADLEASSGVRILYHPADMTRSEEIADMIAFAQRELGRLDILVNNAGIQHVESIE
KFPTDQWEKIIAINLSSAFYATREAIPIMKAQGRGRIINMASAHGLVASPFKSAYVAAKH
GVIGFTKTAALELARDNITCNAICPGFVETPIVTKQIADQARTRNMTEEQVLTDVILAAQ
PTKRFVTTEELTGIFLYLVSDLGASANGASFSIDGGWTAQ