Protein Info for A4249_RS06085 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: peroxide stress protein YaaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF03883: H2O2_YaaD" amino acids 1 to 241 (241 residues), 284.6 bits, see alignment E=6.3e-89 PF21818: DUF6884" amino acids 94 to 178 (85 residues), 33.1 bits, see alignment E=5.6e-12

Best Hits

Swiss-Prot: 64% identical to Y3496_CAUVN: UPF0246 protein CCNA_03496 (CCNA_03496) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K09861, hypothetical protein (inferred from 80% identity to bsb:Bresu_2562)

Predicted SEED Role

"UPF0246 protein YaaA" in subsystem YaaA

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXX5 at UniProt or InterPro

Protein Sequence (256 amino acids)

>A4249_RS06085 peroxide stress protein YaaA (Brevundimonas sp. GW460-12-10-14-LB2)
MLIVLSPAKRLDFTEADAAIPGSDRRFVEDTASLSKTAKRQTKADLRRLMGISDDLATLN
AARFKAFDPESTEGVQAAFAFAGDVYEGLRAREMDADALAFAQNHLRILSGFYGLLRPLD
RIQPYRLEMGTRLKTRRGASLYDFWGDRISKQLNEDAEGQSDPTLVNLASQEYFGAVDAK
ALKLPVVTPQFREEKNGESRIISFFAKKARGAMARFAIDERVERVADLKAFDRDGYAFDK
AASTDAEWIFIRSGNS