Protein Info for A4249_RS05940 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: COX15/CtaA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details PF02628: COX15-CtaA" amino acids 14 to 342 (329 residues), 338.5 bits, see alignment E=1.8e-105

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 74% identity to bsb:Bresu_1903)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYK6 at UniProt or InterPro

Protein Sequence (366 amino acids)

>A4249_RS05940 COX15/CtaA family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MNRFGNPDRNRAVAVWLFATAAVVFLMVVIGGITRLTGSGLSITEWKPIMGAIPPLNDAQ
WAEAFEKYKQIPQYAQVNAGMSLGEFQGIFWWEWLHRLIGRLVGMVFALPLIVFLLCRLA
PARSVFHQWAMPNRLIWRCVLLLALGGLQGLIGWWMVSSGLSERVSVAPERLATHLGLAF
VLFAALIWTGLEAWNGEDHGRPPSGWARGAGLLLGAVFLQCLLGALVAGGHAGLVYTDWP
LMNGAVLPPADWSLGAAAFLHDQALTQFNHRLVAYGLLIAVSIYAFQAWRWRVAEGMGLG
AFTLAGVIWFQALLGIVTLVHAVPVWLGVLHQAGAAIVLATATVNLWLVLRAQPRIFMSG
PRTMGL