Protein Info for A4249_RS05860 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: rhodanese-related sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF17773: UPF0176_N" amino acids 13 to 103 (91 residues), 96 bits, see alignment E=1.4e-31 PF00581: Rhodanese" amino acids 123 to 220 (98 residues), 37.5 bits, see alignment E=2.7e-13

Best Hits

Swiss-Prot: 59% identical to Y1060_CAUVC: UPF0176 protein CC_1060 (CC_1060) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K07146, UPF0176 protein (inferred from 62% identity to bsb:Bresu_0264)

Predicted SEED Role

"Rhodanese domain protein UPF0176, cyanobacterial/alphaproteobacterial subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXU5 at UniProt or InterPro

Protein Sequence (318 amino acids)

>A4249_RS05860 rhodanese-related sulfurtransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MTDHQTSSDQAVRVAALYRFAPVANPEAVRKTLQTVCNAGQVRGTLLVAPEGLNGTIAGS
EAAIAAVLSTIHAMPGFETLEPKYAWTDAVPFHRMKVRVKREIVTMGQPDLDPPNQAGVY
VTPTDWNALIADPETLVIDTRNDYEGEIGAFERAVQPNTRSFRDFPDWFRSEGRALIEQT
GAKRVAMYCTGGIRCEKSTAFLKAEGVENVHHLEGGILRYLETVDEDQSLWHGACFVFDE
RVSVGHGLSQGPHTLCRACRLPVDEAGRASPHYVEGVCCERCHNARDEVQRRRYVERHRQ
MEMARERGETHLGTAQTD