Protein Info for A4249_RS05655 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: twin-arginine translocase TatA/TatE family subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01411: twin arginine-targeting protein translocase, TatA/E family
  • amino acids 3 to 49 (47 residues), 64.3 bits, E=2.9e-22
• PF02416: TatA_B_E
  • amino acids 5 to 50 (46 residues), 32.9 bits, E=1.5e-12

Best Hits

Swiss-Prot: 69% identical to TATA_CAUSK: Sec-independent protein translocase protein TatA (tatA) from Caulobacter sp. (strain K31)

KEGG orthology group: K03116, sec-independent protein translocase protein TatA (inferred from 89% identity to bsb:Bresu_2555)

Predicted SEED Role

"Twin-arginine translocation protein TatA" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

See A0A168NG46 at UniProt or InterPro

Protein Sequence (72 amino acids)

>A4249_RS05655 twin-arginine translocase TatA/TatE family subunit (Brevundimonas sp. GW460-12-10-14-LB2)
MGSMSIWHWAIVIVVIALLFGGRGKLSGIMGDAAKGIRAFKDGLKDEDKKDGPHEGVSSL
PRTEAEKEELKR