Protein Info for A4249_RS05625 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ADP-glyceromanno-heptose 6-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR02197: ADP-glyceromanno-heptose 6-epimerase" amino acids 2 to 322 (321 residues), 411.8 bits, see alignment E=9.1e-128 PF04321: RmlD_sub_bind" amino acids 2 to 272 (271 residues), 39.9 bits, see alignment E=8.1e-14 PF01370: Epimerase" amino acids 2 to 250 (249 residues), 147.9 bits, see alignment E=1e-46 PF01073: 3Beta_HSD" amino acids 3 to 183 (181 residues), 40.7 bits, see alignment E=4.6e-14 PF16363: GDP_Man_Dehyd" amino acids 4 to 272 (269 residues), 64.6 bits, see alignment E=3.3e-21 PF07993: NAD_binding_4" amino acids 60 to 165 (106 residues), 20.9 bits, see alignment E=5.2e-08

Best Hits

KEGG orthology group: K03274, ADP-L-glycero-D-manno-heptose 6-epimerase [EC: 5.1.3.20] (inferred from 78% identity to bsb:Bresu_1927)

Predicted SEED Role

"ADP-L-glycero-D-manno-heptose-6-epimerase (EC 5.1.3.20)" in subsystem LOS core oligosaccharide biosynthesis (EC 5.1.3.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HWI5 at UniProt or InterPro

Protein Sequence (329 amino acids)

>A4249_RS05625 ADP-glyceromanno-heptose 6-epimerase (Brevundimonas sp. GW460-12-10-14-LB2)
MIVVTGGAGFIGSNIVARLTAETAYDVVVCDRLETADLAKWKNLAKHAIADFWSPEELFE
QLERHAERVEAVVHMGAISSTTEPDGNLILRTNFTLSRDLWDWCAIRGSRMIYASSAATY
GDGKTGFNDDDDAESISQLRPLNAYGYSKMLFDQYAVRQADRGQAPRQWAGLKFFNVYGP
NEAHKGGMKSVVAQIWPKVAAGETVTLFRSHNPNYADGGQMRDFVYVDDVVDIIEFLLQS
PQVSGIFNAGSGQARSFADLARATFEAAGKTPSIDYVDTPLSIRDRYQYFTEARMDRIRA
AGFEGQSTPLEEGVRRYVQDFLATADPYR