Protein Info for A4249_RS05595 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details amino acids 328 to 344 (17 residues), see Phobius details amino acids 351 to 383 (33 residues), see Phobius details PF00375: SDF" amino acids 11 to 421 (411 residues), 397.1 bits, see alignment E=4.3e-123

Best Hits

KEGG orthology group: K03309, dicarboxylate/amino acid:cation (Na+ or H+) symporter, DAACS family (inferred from 81% identity to bsb:Bresu_1919)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NG25 at UniProt or InterPro

Protein Sequence (440 amino acids)

>A4249_RS05595 dicarboxylate/amino acid:cation symporter (Brevundimonas sp. GW460-12-10-14-LB2)
MTETKRGGLALHWLMLIGFAVGLIGGLLVNLTLGADTAWVVWLTDNVTGPLGQIFLRLLF
MMVIPLLFSALVVGVAEMGDLSSLGRAGIKTLLLTILVSSIAVVIGLVMVNVFQPGRGVD
PVLAQQLLDQGRAGAAGIVSGAPETIQLGDFFLDLIPSNVFTAASENQILPVMVFALFFG
IGLVMAKSPATDRLQQVIEGMFEVTMKLINLFIKLAPIAIACLMFNLAALFGWDLLVRLA
AYVGVAVGAMAIHMFVVYPLVIWILGGRSPIAFFKGVREPMVVAFSTASSNASLPVSLKA
AEQELKLPRKIARFVLTVGATANQNGTALFEGVTVLFLAQFFGIDLTITQQIIVMLVCIL
GGIGTAGVPAGSLPVVAMILVMVKVPPEGIGLILGVDRFLDMCRTTLNVTGDLVLATVVS
RGEEDEPIDADDVVPVAPPA