Protein Info for A4249_RS05565 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DNA topoisomerase IV subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 733 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 17 to 731 (715 residues), 828 bits, see alignment E=3.2e-253 PF00521: DNA_topoisoIV" amino acids 37 to 475 (439 residues), 498.4 bits, see alignment E=1.8e-153 PF03989: DNA_gyraseA_C" amino acids 552 to 598 (47 residues), 9.9 bits, see alignment 5.5e-05 amino acids 604 to 632 (29 residues), 11.2 bits, see alignment (E = 2e-05) amino acids 658 to 682 (25 residues), 16.4 bits, see alignment (E = 5.1e-07)

Best Hits

Swiss-Prot: 56% identical to PARC_RHIME: DNA topoisomerase 4 subunit A (parC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 86% identity to bsb:Bresu_1979)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HW96 at UniProt or InterPro

Protein Sequence (733 amino acids)

>A4249_RS05565 DNA topoisomerase IV subunit A (Brevundimonas sp. GW460-12-10-14-LB2)
MTIHAPPPEGGRIIDEPMETALSRRYLAYALSTITNRALPDVRDGFKPVHRRILYAMHQM
RLNPQAAARKCAKVVGEVMGGYHPHGDASIYEALVRLAQDFAQRYPLVDGQGNFGNIDGD
SAAAMRYTECKLTPAAVLLLDGIDQDSVDFRATYDDQDEEPIVLPAGFPNLLANGSSGIA
VGMATSIPPHNVGELIDACQALLERPETTTEELVRLVPGPDFPTGGVAVEGHASILDAYE
TGRGGVRLRARWETEDLGRGVWRIIVTEMPYQVQKSRLIEALADLIEHKKAPLLGDVRDE
SAEDIRLILEPKNRTIEPEMLMESLFKLSDLEVRFPINMNVLDASGTPRVMGLKDCLRAF
LDHRREVLNRRSQWRIARVEKRLHLLEGLRIVFLNLDEVIRIVREEEQPKAVLIARFGLT
EVQADFILDTRLRQLARLEEMTIEKEFNALSEELANLKALTSSEGKQWKAISKELEAVRK
ALISPRRTTIAEAVDTSAFVAPEAFIPREAITVILSERGWIRAAKGKVEDPSELKFKEGD
QLAYLVPAYTTDKLLVAASDGRIFTIGADKLASGRGHGEPLRLMIDLDEKAEIINVLAHQ
PGGKLLIASKAGYGFIAPEDDTLAQKRGGKQVLNGEMLAVLRVTGDHVATIGENIKTLIF
PVAELPEMGRGKGVKLQSFKQGGLADIAVFNAENGPEWADGGGRRRNWPDWKDWLGKRAG
AGRQGPRGLRKFR