Protein Info for A4249_RS05525 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: holo-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00516: holo-[acyl-carrier-protein] synthase
  • amino acids 1 to 130 (130 residues), 86.3 bits, E=2e-28
• TIGR00556: phosphopantetheine--protein transferase domain
  • amino acids 2 to 129 (128 residues), 74.9 bits, E=6.4e-25
• PF01648: ACPS
  • amino acids 4 to 105 (102 residues), 58 bits, E=4.6e-20

Best Hits

Swiss-Prot: 78% identical to ACPS_PHEZH: Holo-[acyl-carrier-protein] synthase (acpS) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K00997, holo-[acyl-carrier protein] synthase [EC: 2.7.8.7] (inferred from 89% identity to bsb:Bresu_1966)

Predicted SEED Role

"Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.7)

MetaCyc Pathways

• acyl carrier protein activation (1/1 steps found)
• acyl carrier protein metabolism (1/2 steps found)
• enterobactin biosynthesis (3/11 steps found)
• superpathway of chorismate metabolism (37/59 steps found)
• petrobactin biosynthesis (1/10 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.7

Sequence Analysis Tools

See A0A160HYZ9 at UniProt or InterPro

Protein Sequence (133 amino acids)

>A4249_RS05525 holo-ACP synthase (Brevundimonas sp. GW460-12-10-14-LB2)
MIIGVGADLSDIRRIQASLDRFGDRFKARCFTELERTRSDRKPDPAWSYAKRFAAKEACA
KALGTGMRADVYWRDMGVVNLRSGQPTMALTGHAAEHLARLTPAGHEARIHLTLSDEHPY
ALAFVVIEALPQS