Protein Info for A4249_RS05520 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: pyridoxine 5'-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00559: pyridoxine 5'-phosphate synthase
  • amino acids 6 to 242 (237 residues), 264.7 bits, E=3.7e-83
• PF03740: PdxJ
  • amino acids 6 to 242 (237 residues), 321 bits, E=1.7e-100

Best Hits

Swiss-Prot: 66% identical to PDXJ_CAUVC: Pyridoxine 5'-phosphate synthase (pdxJ) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03474, pyridoxine 5-phosphate synthase [EC: 2.6.99.2] (inferred from 69% identity to pzu:PHZ_c1876)

Predicted SEED Role

"Pyridoxine 5'-phosphate synthase (EC 2.6.99.2)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.6.99.2)

MetaCyc Pathways

• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.99.2

Sequence Analysis Tools

See A0A168NFZ6 at UniProt or InterPro

Protein Sequence (246 amino acids)

>A4249_RS05520 pyridoxine 5'-phosphate synthase (Brevundimonas sp. GW460-12-10-14-LB2)
MRERVRLGVNIDHVATVRNARGGTHPDPARAAEAALAAGADGITAHLREDRRHITDADID
VLSALCARAGKPLNLEMAVTDEMLAIALRHRPHAACLVPERREEVTTEGGLAVAGHEGRI
APVVKALADAGIRVSLFIEPSEAQVEAAAAVGAQVVEFHTGRYCYLTDPAEREVEFERLA
AAAAQADILGLEVHAGHGLDYDTAPRMLAIPEIRELNIGHFLIGDSIFIGLDGAIRRMRA
AMDAAK