Protein Info for A4249_RS05465 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 41% identical to HMUV_MYXXD: Hemin import ATP-binding protein HmuV (hmuV) from Myxococcus xanthus (strain DK 1622)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 61% identity to bsb:Bresu_2517)

Predicted SEED Role

"Vitamin B12 ABC transporter, ATPase component BtuD" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HW79 at UniProt or InterPro

Protein Sequence (251 amino acids)

>A4249_RS05465 ABC transporter ATP-binding protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSLLSLETVQARLGKAVVLDGVSLSVAAGDVVALCGPNGAGKSSAIRAAVGLLETTGGQI
RLGNSDIVDLSHRQRAERVAYLPQERRIAWNLPAVEVAALGAPFLSGADALARARAALDE
VGAGHLADRGVAEMSGGERARVLLARALVVDAPLLLADEPIAGLDPDSQRLVLERLRARA
DNGAGVLVSLHDLTLAATAADRIVVLDQGRVVADAPPIQALSPAILREVFGLDGAWIEGP
NGPLLAARRSQ