Protein Info for A4249_RS04845 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: HAD-IA family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00702: Hydrolase" amino acids 3 to 177 (175 residues), 78.3 bits, see alignment E=1.6e-25 PF13419: HAD_2" amino acids 6 to 182 (177 residues), 62.6 bits, see alignment E=8.3e-21 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 79 to 182 (104 residues), 64 bits, see alignment E=8.8e-22 PF13242: Hydrolase_like" amino acids 138 to 209 (72 residues), 42.7 bits, see alignment E=6.5e-15

Best Hits

KEGG orthology group: None (inferred from 46% identity to bja:bll0796)

Predicted SEED Role

"Putative phosphatase YieH" in subsystem 2-phosphoglycolate salvage

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NF23 at UniProt or InterPro

Protein Sequence (218 amino acids)

>A4249_RS04845 HAD-IA family hydrolase (Brevundimonas sp. GW460-12-10-14-LB2)
MTYDLIIFDYDGVVADSEVLNSTVMAEQLTAIGLPTSLDDVLAAYTGKRWRDNRPVVEAA
LGRACPADFHTTWFATCRQRAPHQLEPVPGLLDFVAARTEPRCIASSSGPDWIGVGLNLF
GLTDHFDGAVFTGLVVERGKPHPDIFLHAAQTMGVNPSRVLVIEDSEPGVTAGVAAGMTV
VGLTAGGHVRDGHAERLTARGAHCIADSYAAVSAFMDR