Protein Info for A4249_RS04835 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: GTPase HflX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR03156: GTP-binding protein HflX" amino acids 14 to 373 (360 residues), 456.8 bits, see alignment E=2.2e-141 PF13167: GTP-bdg_N" amino acids 32 to 118 (87 residues), 100.2 bits, see alignment E=1.6e-32 PF16360: GTP-bdg_M" amino acids 121 to 200 (80 residues), 105.5 bits, see alignment E=3.4e-34 PF01926: MMR_HSR1" amino acids 207 to 329 (123 residues), 72.1 bits, see alignment E=8.5e-24 PF19275: HflX_C" amino acids 347 to 426 (80 residues), 35.7 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: K03665, GTP-binding protein HflX (inferred from 84% identity to bsb:Bresu_1786)

Predicted SEED Role

"GTP-binding protein HflX" in subsystem Hfl operon or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY67 at UniProt or InterPro

Protein Sequence (437 amino acids)

>A4249_RS04835 GTPase HflX (Brevundimonas sp. GW460-12-10-14-LB2)
MTQKLIDHTVPLIRAVVIHPDRRSDSPRLASERLEEAAGLARALDLDVRAEEIVRLRSTT
PATLFGTGKVEELAALVRAADAEAVIIDDALTPVQQRNLEKAWEVKVIDRTGLILEIFGR
RARTKEGRLQVELARLDYERSRLVRTWTHLERQRGGTGSTGGPGETQIELDRRLIADRIV
RLKSELEEVRRTRGLHRKQRQKAPFPTIALVGYTNAGKSTLFNRLTGSEVFAKDLLFATL
DTTQRTIRLPQGRPAIVADTVGFISDLPHELVESFRATLEEVGEADLILHVRDIASPDSA
AQAKDVEAVLKHIETPEGKTRRVLEVWNKIDLLDDEARETVLGQAERLAKDGEAVAVSAW
TGEGIEPLRQIIAGLIDDDPETQLTLEPHQGDALAWLYEHGRVTARDADELGRTHVTVRL
HPAALGRFERLYPDLTD