Protein Info for A4249_RS04805 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12804: NTP_transf_3
  • amino acids 5 to 131 (127 residues), 54.8 bits, E=2e-18
• PF01128: IspD
  • amino acids 6 to 217 (212 residues), 191.6 bits, E=2.6e-60
• TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • amino acids 6 to 217 (212 residues), 201.6 bits, E=1.1e-63
• TIGR00151: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  • amino acids 226 to 379 (154 residues), 213.2 bits, E=2e-67
• PF02542: YgbB
  • amino acids 226 to 378 (153 residues), 215.3 bits, E=8.5e-68

Best Hits

Swiss-Prot: 64% identical to ISPDF_CAUVC: Bifunctional enzyme IspD/IspF (ispDF) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K12506, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC: 2.7.7.60 4.6.1.12] (inferred from 72% identity to bsb:Bresu_1780)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.7.60, EC 4.6.1.12)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• isoprene biosynthesis I (9/10 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60 or 4.6.1.12

Sequence Analysis Tools

See A0A160HY49 at UniProt or InterPro

Protein Sequence (383 amino acids)

>A4249_RS04805 bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Brevundimonas sp. GW460-12-10-14-LB2)
MTFSGIIVAAGSGSRAGGDKQWRDLGGKPVLRWPAEALLNAGADELIVVIAPDALDRVAE
VLSGLPRWRAVVGGAARADSVRAGLAALTCGTDQPVLIHDAARPLLDAAVIDRLLSALET
SNGALPALPVADSLRRGEAEIMTDVVDRDGLWRAQTPQAFRRGVIETAYAAWSDAEVPTD
EAVVVQRNGGAVALVQGDARLMKLTYPEDFAMAEALLPQAQRYQTRIGSGYDVHRWGPGG
SVWLCGIEVPHDQTLIGHSDADAGLHALTDAILGAIAAGDIGDHFPPTDPKWKGASSDQF
LIHAAELVAARGGRIVNVDVTLICERPKVKPHRQAMRDRIAGLLNLPLDAVSVKATTTEG
LGFTGRGEGLAAQAVATVETPVV