Protein Info for A4249_RS04740 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: septal ring lytic transglycosylase RlpA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF03330: DPBB_1" amino acids 73 to 162 (90 residues), 88.5 bits, see alignment E=2.9e-29 TIGR00413: rare lipoprotein A" amino acids 75 to 167 (93 residues), 146.8 bits, see alignment E=4.1e-47 PF05036: SPOR" amino acids 210 to 273 (64 residues), 28.7 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: K03642, rare lipoprotein A (inferred from 62% identity to bsb:Bresu_1995)

Predicted SEED Role

"Rare lipoprotein A precursor" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161IXK4 at UniProt or InterPro

Protein Sequence (279 amino acids)

>A4249_RS04740 septal ring lytic transglycosylase RlpA family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTFGQGVRGALILGLFSVLAACSTAGGVDVGGLRGEARLPVVKDPAPIVSGTMRPYQVRG
RWYTPKEQPDYEEVGMASWYGDAFNGRPTSTGERFDMHALTAAHKTLPLPGLVEVTNLEN
GRRLVVRINDRGPFVDSRIIDLSREAASELGMLSQGVGRVRVRYLGRAPQQGGGPLLRAS
VPTPRGAVPASTPVSVAAIAPAPVAVAEVTTFWVQAGSFSDQVEAGRIADSLSGWVRADR
GAGRFNVVVGPWDSANAAEAARQSVVARGYAGALLISGS