Protein Info for A4249_RS04720 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: acyl-CoA dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 91 to 109 (19 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 5 to 125 (121 residues), 63 bits, see alignment E=5.1e-21 PF02770: Acyl-CoA_dh_M" amino acids 129 to 223 (95 residues), 73.1 bits, see alignment E=2.5e-24 PF00441: Acyl-CoA_dh_1" amino acids 235 to 388 (154 residues), 78.2 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: None (inferred from 84% identity to bsb:Bresu_0921)

Predicted SEED Role

"acyl-CoA dehydrogenase domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY29 at UniProt or InterPro

Protein Sequence (393 amino acids)

>A4249_RS04720 acyl-CoA dehydrogenase family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTDLEQFRAETRAWLEANCPAECRGPMADDEMIWGGRYPTFKTPAHKLWLERMGARGWTA
PEWPKEYGGGGLSREEAKVLASELRRIKAQPALASFGVWMLGPALLAFGTDEQKKRFLPE
IVRGEIRWCQGYSEPGAGSDLASIQTRAEDRGDHWIVNGQKIWTSYADKADWIFCLVRTD
PEAPKHLGISFVLFDMKTPGVTTRPITLISGKSPFCETFFDDVRVEKENLVGTLNRGWDV
AKYLLAHERTMIGAMGEVGGGRPVGQVALDAIGADEAGRLDEPMLRARIADLEIDAATFR
LAMERVGDQVKAKQAHPAIASMLKYYGSELNKRRQELLMAAGGADALEWEGERSHDGKAA
RDWLRTKANSIEGGTSEVQLNIIAKHLLQLPGA