Protein Info for A4249_RS04715 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: rod shape-determining protein RodA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 315 to 342 (28 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details TIGR02210: rod shape-determining protein RodA" amino acids 23 to 373 (351 residues), 394.5 bits, see alignment E=2.3e-122 PF01098: FTSW_RODA_SPOVE" amino acids 33 to 373 (341 residues), 302.1 bits, see alignment E=2.6e-94

Best Hits

KEGG orthology group: K05837, rod shape determining protein RodA (inferred from 79% identity to bsb:Bresu_2295)

Predicted SEED Role

"Rod shape-determining protein RodA" in subsystem Bacterial Cytoskeleton or Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NEW9 at UniProt or InterPro

Protein Sequence (384 amino acids)

>A4249_RS04715 rod shape-determining protein RodA (Brevundimonas sp. GW460-12-10-14-LB2)
MTASALSRPGERERVSTKLGQIDWRLTALLCVVSGTGALMLYSVAGGSWSPWAMKHLIRF
GMCLALMLMLSLISIRYWFALAYPIYGMALFMLALVETPLGYTALGATRWLDLGFTRIQP
SEIMKIGVVLALARWYHGASAKEASFHWKLIFPVGIIGLPFLLVAHQPDLGSAMLIGLTG
AAIMFVAGLSWRIILPLIIAAAVLVPPYVMFGMHDYQRHRVLTFLNPEADMSDKGYQIVQ
SKIAMGSGGPLGRGFGLGSQSQLEFLPERQTDFIFAAFAEEFGFVGTFTLLASYAAIILI
SLRIASLSHSHFGRLAASGVTATFALYVLINGAMVMGLAPVVGVPMPLLSYGGTVMLTVM
IGFGLVMATRVHRYAELPKGHGLI