Protein Info for A4249_RS04705 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 49 to 77 (29 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 69% identity to bsb:Bresu_2297)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY52 at UniProt or InterPro

Protein Sequence (172 amino acids)

>A4249_RS04705 hypothetical protein (Brevundimonas sp. GW460-12-10-14-LB2)
MRRPVAVRVVGPLQWIVYPALLVLAATVVLGTPLQLFGLHLPEPVIPMILAFAWPLIRPS
MLAPAVLFLIGLFLDLFWNTPLGLWALCLMGVYGTVLLSRNLLAGHEGMIRFGAYAACTL
GAFFLAYLVVTMRATNAPAILPLVGQVVPTLLLFPIANWMLERFDDGDIRFR