Protein Info for A4249_RS04670 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: protein translocase subunit SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 279 to 308 (30 residues), see Phobius details TIGR00966: protein-export membrane protein SecF" amino acids 46 to 299 (254 residues), 256.6 bits, see alignment E=2.8e-80 PF07549: Sec_GG" amino acids 46 to 61 (16 residues), 22.7 bits, see alignment (E = 5.5e-09) PF02355: SecD_SecF_C" amino acids 133 to 308 (176 residues), 219.2 bits, see alignment E=3.3e-69 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 133 to 297 (165 residues), 169.3 bits, see alignment E=1e-53

Best Hits

KEGG orthology group: K03074, preprotein translocase subunit SecF (inferred from 88% identity to bsb:Bresu_2618)

Predicted SEED Role

"Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY23 at UniProt or InterPro

Protein Sequence (329 amino acids)

>A4249_RS04670 protein translocase subunit SecF (Brevundimonas sp. GW460-12-10-14-LB2)
MAMRGWPLIKLLPQKTNFHFVKYARFAGVLSVILCVAAIVSCFYPGLNMGIDFRGGASME
VSKPAGQTIELDRVREAVNGLNLGDVQVQGIARRDTNVDDGSTAILRFQVPEGRDQTQVV
NQVEGAISGAVGQVNYSGVSVVGSKVSGELFTSGLLALGVAIGLMFLYIWFRFEPQFGFG
AVVGLLHDVILTFGLIVLFKLEFSLNMVAAVLTVIGYSMNDTVVVFDRLRENLRKYKTMP
LRDVIDLSLNETLSRTIITGVTAVMVLAALAIFGGEALFGFSIALMFGIIIGTYSSIYVG
APIILLWGVKRGALADDAKPVKLGMASRP