Protein Info for A4249_RS04660 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: preprotein translocase subunit YajC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details PF02699: YajC" amino acids 14 to 89 (76 residues), 90.7 bits, see alignment E=2.2e-30 TIGR00739: preprotein translocase, YajC subunit" amino acids 14 to 90 (77 residues), 78.1 bits, see alignment E=2.1e-26

Best Hits

Swiss-Prot: 43% identical to YAJC_BRUAB: Sec translocon accessory complex subunit YajC (yajC) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 83% identity to bsb:Bresu_2620)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXB4 at UniProt or InterPro

Protein Sequence (103 amino acids)

>A4249_RS04660 preprotein translocase subunit YajC (Brevundimonas sp. GW460-12-10-14-LB2)
MGAEGGLTAQLIGFAPIIGIFILFYFLLIRPQQKRAKEHATAIAAVKRGDTVVLGSGMIG
KVTRVEEAEVNVEIAPSVNVRVVKAMIAEVRNRTAIAANDSKA