Protein Info for A4249_RS04625 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: 50S ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 39 to 286 (248 residues), 213.2 bits, E=1.7e-66
• PF13489: Methyltransf_23
  • amino acids 138 to 285 (148 residues), 32.9 bits, E=1.6e-11
• PF05175: MTS
  • amino acids 143 to 223 (81 residues), 36.9 bits, E=8.7e-13
• PF13847: Methyltransf_31
  • amino acids 150 to 241 (92 residues), 37.6 bits, E=5.9e-13
• PF13649: Methyltransf_25
  • amino acids 152 to 244 (93 residues), 43 bits, E=1.9e-14
• PF08241: Methyltransf_11
  • amino acids 153 to 247 (95 residues), 27 bits, E=1.7e-09

Best Hits

Swiss-Prot: 66% identical to PRMA_CAUSK: Ribosomal protein L11 methyltransferase (prmA) from Caulobacter sp. (strain K31)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 71% identity to bsb:Bresu_1622)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A160HW52 at UniProt or InterPro

Protein Sequence (287 amino acids)

>A4249_RS04625 50S ribosomal protein L11 methyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MSESALQIIARGPRAAAEAAAEAVDADPRLEGATYSILEEDEDNDVWRIDAFPTTDDEVE
GLKAVLAGYPVTVLVEKLADADWLAMSLSGLPPVEAGRFFVYGAHDQGKVPDGRVTLKID
AGAAFGTGHHGTTVGCLEAFDKLLETESFEKVLDVGCGTGVLAIAAAKTGTPIAVGTDID
EPSARIANENAEINEAKCDFYFADGLSDPRIAQHQPYDLVFANILAAPLVHLAPEIAAAL
KSGGVAILSGLLRTQEERVLEAYLPLGFTVEQTIHHDAWSALQLRKG