Protein Info for A4249_RS04590 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01979: cysteine desulfurase, SufS family
  • amino acids 14 to 411 (398 residues), 543.2 bits, E=1.8e-167
• PF00266: Aminotran_5
  • amino acids 32 to 400 (369 residues), 473.1 bits, E=1.3e-145
• PF00155: Aminotran_1_2
  • amino acids 73 to 249 (177 residues), 34.3 bits, E=3.2e-12
• PF01041: DegT_DnrJ_EryC1
  • amino acids 73 to 211 (139 residues), 26.3 bits, E=8.5e-10

Best Hits

Swiss-Prot: 51% identical to CSD_STRCO: Probable cysteine desulfurase (csd) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 77% identity to bsb:Bresu_2177)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of L-alanine biosynthesis (4/4 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (2/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (2/4 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (2/5 steps found)
• molybdopterin biosynthesis (1/6 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (2/8 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (2/11 steps found)

KEGG Metabolic Maps

• Selenoamino acid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Sequence Analysis Tools

See A0A160HYM7 at UniProt or InterPro

Protein Sequence (412 amino acids)

>A4249_RS04590 cysteine desulfurase (Brevundimonas sp. GW460-12-10-14-LB2)
MADGAVVNTFDPYAVRAQFPILSRQVNGKPLVYLDNAASSQKPRAVIDALVETMEGGYAN
VHRGLHTLSNEATEAFEKAREIVARFLNAESAEQVVWTKGGTEAINLVANGLGLSIQPGD
EIIVSEMEHHSNIVPWHLLRERRGAVIKWIPVKDDGSLDMAAYAALLGPRTRMVAVTHMS
NVLGTINPVAEISRLAHAAGAQVLIDGCQGAVHATPDVQAIGCDFYVLTGHKLFAPTGIG
ALYGKAEALEALPPYQGGGEMIETVEQDRVTYARPPHRFEAGTPPILEAIGLGVGLEWLA
QYDRAAVQAHEHALYQHAVDRLQGQNWLRILGQAEGKGAILTFAVEGAHAHDVAQIMDRY
GVAVRAGLHCAEPLAKRMGVTSSTRASFALYNTVEDADAFVDALIKARNFFV