Protein Info for A4249_RS04470 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 119 to 151 (33 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details PF02518: HATPase_c" amino acids 331 to 431 (101 residues), 65.4 bits, see alignment E=3e-22

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 52% identity to bra:BRADO1724)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2F2 at UniProt or InterPro

Protein Sequence (443 amino acids)

>A4249_RS04470 ATP-binding protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTTTTVQRLLGLGLRGGVATHGGANRRNMLLLIQLRWLAVAGQVATILLVQYVMRIPLPV
LWLLAAPAGLVLVNLVSAPLTVRTQEVEDQALMIALLADVAALTWLLFLTGGAANPFVAL
YLLQVVLGAVLLAPVYAWALIAITSLCFAGLGLHSRPLNLPPAREDSLLSLYLQGSLICF
VLMAVLLVLFVTRISQNLRERDASMAALRQQTAEHDHIVRMGLLASGAAHELGTPLASLS
VILSDWKRMPALTRDADLAQDMTVMRAEVERCKAIVTGILMSAGEARGQAPERTTLRAFV
ADVVASWSGDGVAVQIRDELAQNPSIIADPALRQVLGVLFDNAVEAGASRITVTTTRTDE
DFGIVVRDDGPGFPPAILQAWGKPYNSTKPRPGAGLGLFLLMNVIRSLGGRVEASNPPAG
GAEVRLTLPLSALAPTHEIAHDR