Protein Info for A4249_RS04450 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cytochrome o ubiquinol oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 198 to 222 (25 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details amino acids 426 to 449 (24 residues), see Phobius details amino acids 461 to 482 (22 residues), see Phobius details amino acids 502 to 527 (26 residues), see Phobius details amino acids 595 to 614 (20 residues), see Phobius details amino acids 617 to 638 (22 residues), see Phobius details TIGR02843: cytochrome o ubiquinol oxidase, subunit I" amino acids 11 to 655 (645 residues), 1122.9 bits, see alignment E=0 PF00115: COX1" amino acids 65 to 511 (447 residues), 488.7 bits, see alignment E=8e-151

Best Hits

Swiss-Prot: 67% identical to CYOB_ECOLI: Cytochrome bo(3) ubiquinol oxidase subunit 1 (cyoB) from Escherichia coli (strain K12)

KEGG orthology group: K02298, cytochrome o ubiquinol oxidase subunit I [EC: 1.10.3.-] (inferred from 83% identity to mlo:mlr6847)

MetaCyc: 67% identical to cytochrome bo3 subunit 1 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HW28 at UniProt or InterPro

Protein Sequence (667 amino acids)

>A4249_RS04450 cytochrome o ubiquinol oxidase subunit I (Brevundimonas sp. GW460-12-10-14-LB2)
MNADQLIPLIFGRLTLEALPLHEPILVVTMSVVLLGGLALFGALTYFKLWGYLWKEWFTT
VDHKKIGIMYMILGLIMFVRGFADAIMMRLQQAMAFGGSEGYLNAHHYDQIFTAHGVIMI
FFVAMPLVTGIMNYVVPLQIGARDVSFPFLNNFSFWMTTAGAIIVMASLFVGEFARTGWL
AYPPLSGIGYSPGVGVDYYIWALQIAGVGTTLSGINLIATIVKMRAPGMGMMKMPVFTWT
SLCTNVLIVASFPVLTAVLALLTLDRYVGTNFFTNDFGGNPMMYVNLIWIWGHPEVYILI
LPLFGVFSEIASTFSGKKLFGYTSMVYATVVITILSYLVWLHHFFTMGSGASVNSFFGIT
TMIISIPTGAKIFNWLFTMYRGRIRFELPMMWLVAFMLTFVIGGMTGVLLAVPPADFVLH
NSLFLVAHFHNVIIGGVLFGLFAAINFWWPKAFGFKLDKKWGLISFWCWVPGFWLAFLPL
YVLGLMGVTRRMRVFDDPSLQIWFVIAAIGAGVIALGIAAMFIQFAVSIINRDKLRDTTG
DPWGGRTLEWATSSPPPAYNFAATPYVHDADAWWDMKKQGYQRPLNGYKAIHMPSNTGAG
IIISGLCLVMGLALIWYIWWLAAISFIGVLAVSIGHTFNYKRDYYIPEDEVRATEEARTR
ALAGTEA