Protein Info for A4249_RS04420 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 268 to 289 (22 residues), see Phobius details PF02743: dCache_1" amino acids 10 to 253 (244 residues), 59.4 bits, see alignment E=5.6e-20 PF00512: HisKA" amino acids 357 to 421 (65 residues), 32.7 bits, see alignment E=9.1e-12 PF02518: HATPase_c" amino acids 466 to 569 (104 residues), 75.5 bits, see alignment E=6.6e-25

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 60% identity to bsb:Bresu_3004)

Predicted SEED Role

"Signal transduction histidine kinase regulating C4-dicarboxylate transport system"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NWY6 at UniProt or InterPro

Protein Sequence (571 amino acids)

>A4249_RS04420 ATP-binding protein (Brevundimonas sp. GW460-12-10-14-LB2)
MARRDAQIELARQTEAAAALHAAVLRSELEKHRSLPLALASDPDIAALLSAPQTAKGDPV
SLKLETLARQTRAAAIYIIDANGRTRAASNWRLPTSFVGADYGFRPYFINAMRQGQAEFF
ALGTVSGRPGLYLARRVDGSSSSAVGVVVVKVEFATLEAEWRASGEPAYVVDPGGVVLIT
SVPAWRFRTTEALDERRRRLTLTDQTLQPEALRPLPFVTPPNDRPRLIQAPVDGREQRWM
HAAIPTETPGWTLHLLSPDRGSIGTAVATARALAALIVTLLAGVIVVLLRRRHQALVRAR
AEEEARLELERLIDERTHELRNANAALNRQIEERRRAETARELLRDELVQASKLAALGQI
VASVAHEINQPVAAIQTQAETAGVLLDRDEPAKARGALARISDLTQRIGAITEGLSVFSR
KSDPKIGIVRLEDAIYGALLLTRGRLDEGGVKLIREGDANVTVRADRFRLEQVIVNLVKN
ASEALEDCDRPRLTLKVSRDKDRVRLSISDNGPGVPPAVRAQLFTPFVTTRANGLGLGLV
ICRDLVAGFGGELDLVDEDVGATFVATLRIA