Protein Info for A4249_RS04410 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: sterol desaturase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 124 to 258 (135 residues), 93.2 bits, see alignment E=9.4e-31

Best Hits

KEGG orthology group: None (inferred from 55% identity to bsb:Bresu_2481)

MetaCyc: 95% identical to carotenoid 2,2'-beta-ionone ring hydroxylase (Brevundimonas vesicularis)
1.14.13.-,1.14.13.-; 1.14.13.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYK4 at UniProt or InterPro

Protein Sequence (269 amino acids)

>A4249_RS04410 sterol desaturase family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTHHRRFTDRASRLDPARRFAVCAPMLKDLFVTTLALSLIIGVRYLLVGVVTHGLLWGGA
GRGRQLNHRPPAAKRIRAEVIASLIACPIYALPAAFVIELWKRGGTAIYDDIHAWPLWWL
PVSFIVYMLAHDAFYYWVHRGLHYPRVFPWAHAEHHRSHDPSAFASFAFDPAEAIATAWF
LPALTLFIPIHWGVALALLTLMTATAVLNHAGREVWPASWLKRAPLRWMITATHHDAHHK
RFNGNYGLYFQMWDRWAGSEISSARRKRG